PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_02244A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 369aa    MW: 39730.4 Da    PI: 8.3688
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_02244AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61e-1675120147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                rg W + Ed +l d+v+++G+++W++Ia+++  gR++k+c++rw++ 
  Oropetium_20150105_02244A  75 RGHWRPAEDAKLRDLVALHGPHNWNLIAEKLD-GRSGKSCRLRWFNQ 120
                                899*****************************.***********996 PP

2Myb_DNA-binding52.21.4e-16128170246
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                 +++ eE+e+l  a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Oropetium_20150105_02244A 128 RPFSDEEEERLMAAHRFYGNK-WAMIARLFP-GRTDNAVKNHWHV 170
                                68*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.63870121IPR017930Myb domain
SMARTSM007176.4E-1474123IPR001005SANT/Myb domain
PfamPF002495.3E-1675120IPR001005SANT/Myb domain
SuperFamilySSF466898.99E-2875168IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-2576128IPR009057Homeodomain-like
CDDcd001672.25E-1378119No hitNo description
PROSITE profilePS5129424.91122176IPR017930Myb domain
SMARTSM007174.9E-13126174IPR001005SANT/Myb domain
PfamPF002498.3E-13127169IPR001005SANT/Myb domain
CDDcd001678.58E-11129169No hitNo description
Gene3DG3DSA:1.10.10.604.6E-20129175IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MPCSSPPPPW LLRVGSAAAT DQQQXXXXXX XXXXGRVLTA GTTTMDDTGG GGATAAADHQ  60
ESSSSGQSRL AAAARGHWRP AEDAKLRDLV ALHGPHNWNL IAEKLDGRSG KSCRLRWFNQ  120
LDPRISKRPF SDEEEERLMA AHRFYGNKWA MIARLFPGRT DNAVKNHWHV IMARKYREQS  180
TAYRRRKLNQ AVQRKLEASV ATTMTPAAAG DAIVVGHHHL LAHDDAADPY GFALRHYCSF  240
VPLPPAGAEE PPPPPFCLFP GLPGAAHADR RLLLPWQHPP DAVLGRGGVV DARYGAEQPP  300
PPPPPLLLPL TVPSAWMDRG HLEPPQFISE PAAAAFAGTA AARDDASGTH SAAPPPPAFI  360
DFLGVGAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-31751757107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445547.11e-112hypothetical protein SORBIDRAFT_07g021280
TrEMBLA0A096TRF21e-125A0A096TRF2_MAIZE; Uncharacterized protein
STRINGGRMZM2G428555_P031e-124(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-71myb domain protein 105